PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10003216m
Common NameEUTSA_v10003215mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 423aa    MW: 47182.8 Da    PI: 8.9578
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10003216mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.11.7e-40170245277
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      CqvegC+ dls+ak+yhr+h++Ce hsk p+v+vsg+e+rfCqqCsrfh lsefDe+krsCrrrL++hn+rrrk++
  Thhalv10003216m 170 CQVEGCNLDLSSAKDYHRKHRICENHSKFPKVVVSGVERRFCQQCSRFHCLSEFDEKKRSCRRRLSDHNARRRKPN 245
                      **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.1E-33163231IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.795167244IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-38168248IPR004333Transcription factor, SBP-box
PfamPF031103.2E-31170243IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MECNAKPPLQ WEWENLISFG TSSAEIPRKL RPMDWEIDGF DCTSLYSSSF AAVAYGGSSG  60
SDLAHAFSKS SKSTSISSSS AEVRTYNFTS EAGESEEFVK GMNTSPSLEL SFGSGDPVLG  120
LKLGKRTYFE DFLDVENAKV SALPVSLASS SASPVKKSKS VSQRLQTPHC QVEGCNLDLS  180
SAKDYHRKHR ICENHSKFPK VVVSGVERRF CQQCSRFHCL SEFDEKKRSC RRRLSDHNAR  240
RRKPNPGRTY DGKHQMDFVW NRFALIHPRS EEKFLWPSSK PLPSKGLMPQ HAKTEMSNKL  300
FTEQCGFGLL DPKTKTTRAE LFSKDKVTIS SHMGTSQDLD GALSLLSNST SWVSSDQPRR  360
FTLDHHPTSN VQPVAHRSAS QLNSVSGYWQ PNPPAVEPSN ALHRNGVGQF NESFFSLNQF  420
YN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-261702431184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225242KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531810.0AK353181.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-38-E06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403271.10.0hypothetical protein EUTSA_v10003215mg
RefseqXP_006403270.10.0hypothetical protein EUTSA_v10003215mg
SwissprotQ9S8400.0SPL2_ARATH; Squamosa promoter-binding-like protein 2
TrEMBLE4MXD40.0E4MXD4_EUTHA; mRNA, clone: RTFL01-38-E06
TrEMBLV4LXV80.0V4LXV8_EUTSA; Uncharacterized protein
STRINGscaffold_800740.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.30.0squamosa promoter binding protein-like 2